ACGTN

MAST results in plain text format.

MAST results in XML format.

The name of the query motif, which is unique in the motif database file.

An alternate name for the query motif, which may be provided in the motif database file.

The width of the motif. No gaps are allowed in motifs supplied to MAST as it only works for motifs of a fixed width.

The sequence that would achieve the best possible match score (and its reverse complement for nucleotide motifs).

MAST computes the pairwise correlations between each pair of motifs. The correlation between two motifs is the maximum sum of Pearson's correlation coefficients for aligned columns divided by the width of the shorter motif. The maximum is found by trying all alignments of the two motifs.

Motifs with correlations below 0.60 have little effect on the accuracy of the E-values computed by MAST. Motifs with higher correlations with other motifs should be removed from the query. You can also request MAST to remove redundant motifs from its analysis under Advanced options from the MAST web page, or by specifying --remcorr when running MAST on your own computer.

The name of the (FASTA) sequence database file.

The number of sequences in the database.

The number of letters in the sequence database.

The date of the last modification to the sequence database.

The name of a file of motifs ("motif database file") that contains the (MEME-formatted) motifs used in the search.

The date of the last modification to the motif database.

The name of the alphabet symbol.

The frequency of the alphabet symbol as defined by the background model.

The score for the match of a position in a sequence to a motif is computed by summing the appropriate entry from each column of the position-dependent scoring matrix that represents the motif. Sequences shorter than one or more of the motifs are skipped.

The p-value of a motif match is the probability of a single random subsequence of the length of the motif scoring at least as well as the observed match.

The identifier of the sequence (from the FASTA sequence header line). This maybe be linked to search a sequence database for the sequence name.

The description appearing after the identifier of the sequence in the FASTA header line.

This diagram shows the normal spacing of the motifs specified to MAST.

MAST will calculate larger p-values for sites that diverge from the order and spacing in the diagram.

The E-value of the sequence.

If strands were scored separately then there will be two E-values for the sequence separated by a slash (/). The score for the provided sequence will be first and the score for the reverse-complement will be second.

The block diagram shows the best non-overlapping tiling of motif matches on the sequence. These motif matches are the ones used by MAST to compute the E-value for the sequence. Hovering the mouse cursor over a motif match causes the display of the motif name, position p-value of the match and other details in the hovering text.

The combined p-value of the sequence.

If strands were scored separately with a complementable alphabet then there will be two p-values for the sequence separated by a slash (/). The score for the given sequence will be first and the score for the reverse-complement will be second.

This indicates the offset used for translation of the DNA.

The annotated sequence shows a portion of the sequence with the matching motif sequences displayed above.

The displayed portion of the sequence can be modified by sliding the two buttons below the sequence block diagram so that the portion you want to see is between the two needles attached to the buttons. By default the two buttons move together but you can drag one individually by holding shift before you start the drag.

If the strands were scored separately then overlaps in motif sites may occur so you can choose to display only one strand at a time. This is done by selecting "Matches on given strand" or "Matches on opposite strand" from the drop-down list.

The sequence p-value of a score is defined as the probability of a random sequence of the same length containing some match with as good or better a score.

The combined p-value of a sequence measures the strength of the match of the sequence to all the motifs and is calculated by

  1. finding the score of the single best match of each motif to the sequence (best matches may overlap),
  2. calculating the sequence p-value of each score,
  3. forming the product of the p-values,
  4. taking the p-value of the product.

The E-value of a sequence is the expected number of sequences in a random database of the same size that would match the motifs as well as the sequence does and is equal to the combined p-value of the sequence times the number of sequences in the database.

Motif1
p-value8.23e-7
Start23
End33
Change the portion of annotated sequence by dragging the buttons; hold shift to drag them individually.
Sequence Comment:
Combined p-value:
/
Annotated Sequence

For further information on how to interpret these results http://meme-suite.org/.
To get a copy of the MEME software please access http://meme-suite.org.

If you use MAST in your research, please cite the following paper:
Timothy L. Bailey and Michael Gribskov, "Combining evidence using p-values: application to sequence homology searches", Bioinformatics, 14(1):48-54, 1998. [pdf]

Your browser does not support canvas!

Motifs

Next Top
Name 
Alt. Name 
Width 
Motif Similarity Matrix 
1.2.3.4.5.6.7.8.9.10.
1.EKRQRRMJSNRESARRSRMRKQAYLEELEMEME-129--0.180.110.120.160.140.150.220.280.12
2.SQQYTLVZRDNSVLRAZNSELKQRLQSLEMEME-2290.18--0.190.190.190.160.260.190.510.19
3.LNHYDEJFRLKATAAKADVFYLJSGMWKTPAERFFLWIGGFRPSELLKVLMEME-3500.110.19--0.190.160.130.160.10.160.21
4.GKTLGEMTLEEFLVNAGVVEEMEME-4210.120.190.19--0.250.30.170.190.170.21
5.ALEGFVRQADHLRQQTLQQMHRILTTRQAARGLLAJGEYFHRLRALSSLMEME-5490.160.190.160.25--0.140.150.20.250.16
6.GKGLVSGGSLQRQGSLSLPRTLSQKTVDEVWKEIQKEQDGGKQMEME-6430.140.160.130.30.14--0.150.160.20.14
7.FGLSGTVNSGIAAFEMEYGRWVEEQNRQICELRTALNAHISDIELRILVEMEME-7500.150.260.160.170.150.15--0.130.290.18
8.PQJEPLTEQQLLEVCNLQQSSQQAEDALSQGLEKLQQSLAETVASGMEME-8460.220.190.10.190.20.160.13--0.270.14
9.ZVEQLREENAELRKKMEME-9150.280.510.160.170.250.20.290.27--0.15
10.MSPVVSEILRSGFMINSSLRRRTHLVQSFSVVFLYCGNSMEME-10390.120.190.210.210.160.140.180.140.15--

Search Results

Prev Next Top

Top Scoring Sequences

Each of the following 85 sequences has an E-value less than 10.
The motif matches shown have a position p-value less than 0.0001.
Hover the cursor over the sequence name to view more information about a sequence.
Hover the cursor over a motif for more information about the match.
Click on the arrow (↧) next to the E-value to see the sequence surrounding each match.

EKRQRRMJSNRESARRSRMRKQAYLEELE
SQQYTLVZRDNSVLRAZNSELKQRLQSLE
LNHYDEJFRLKATAAKADVFYLJSGMWKTPAERFFLWIGGFRPSELLKVL
GKTLGEMTLEEFLVNAGVVEE
ALEGFVRQADHLRQQTLQQMHRILTTRQAARGLLAJGEYFHRLRALSSL
GKGLVSGGSLQRQGSLSLPRTLSQKTVDEVWKEIQKEQDGGKQ
FGLSGTVNSGIAAFEMEYGRWVEEQNRQICELRTALNAHISDIELRILVE
PQJEPLTEQQLLEVCNLQQSSQQAEDALSQGLEKLQQSLAETVASG
ZVEQLREENAELRKK
MSPVVSEILRSGFMINSSLRRRTHLVQSFSVVFLYCGNS
Sequence 
E-value 
Block Diagram 
0
100
200
300
400
500
600
GrbZIP509.1e-205
1
1
Change the portion of annotated sequence by dragging the buttons; hold shift to drag them individually.
Sequence Comment:
Combined p-value:
1.1e-206 /
Annotated Sequence
GrbZIP472.5e-202
1
1
Change the portion of annotated sequence by dragging the buttons; hold shift to drag them individually.
Sequence Comment:
Combined p-value:
2.9e-204 /
Annotated Sequence
GrbZIP22-11.6e-198
1
1
Change the portion of annotated sequence by dragging the buttons; hold shift to drag them individually.
Sequence Comment:
Combined p-value:
1.8e-200 /
Annotated Sequence
GrbZIP22-25.4e-196
1
1
Change the portion of annotated sequence by dragging the buttons; hold shift to drag them individually.
Sequence Comment:
Combined p-value:
6.3e-198 /
Annotated Sequence
GrbZIP453.8e-184
1
1
Change the portion of annotated sequence by dragging the buttons; hold shift to drag them individually.
Sequence Comment:
Combined p-value:
4.4e-186 /
Annotated Sequence
GrbZIP571.8e-177
1
1
Change the portion of annotated sequence by dragging the buttons; hold shift to drag them individually.
Sequence Comment:
Combined p-value:
2.1e-179 /
Annotated Sequence
GrbZIP206.7e-177
1
1
Change the portion of annotated sequence by dragging the buttons; hold shift to drag them individually.
Sequence Comment:
Combined p-value:
7.8e-179 /
Annotated Sequence
GrbZIP213.7e-166
1
1
Change the portion of annotated sequence by dragging the buttons; hold shift to drag them individually.
Sequence Comment:
Combined p-value:
4.4e-168 /
Annotated Sequence
GrbZIP652.5e-163
1
1
Change the portion of annotated sequence by dragging the buttons; hold shift to drag them individually.
Sequence Comment:
Combined p-value:
2.9e-165 /
Annotated Sequence
GrbZIP44-21.9e-84
1
1
Change the portion of annotated sequence by dragging the buttons; hold shift to drag them individually.
Sequence Comment:
Combined p-value:
2.2e-86 /
Annotated Sequence
GrbZIP36-31.1e-81
1
1
Change the portion of annotated sequence by dragging the buttons; hold shift to drag them individually.
Sequence Comment:
Combined p-value:
1.3e-83 /
Annotated Sequence
GrbZIP36-13.7e-80
1
1
Change the portion of annotated sequence by dragging the buttons; hold shift to drag them individually.
Sequence Comment:
Combined p-value:
4.2e-82 /
Annotated Sequence
GrbZIP44-18.1e-80
1
1
Change the portion of annotated sequence by dragging the buttons; hold shift to drag them individually.
Sequence Comment:
Combined p-value:
9.5e-82 /
Annotated Sequence
GrbZIP44-32.5e-78
1
1
Change the portion of annotated sequence by dragging the buttons; hold shift to drag them individually.
Sequence Comment:
Combined p-value:
2.9e-80 /
Annotated Sequence
GrbZIP11-13.1e-77
1
1
Change the portion of annotated sequence by dragging the buttons; hold shift to drag them individually.
Sequence Comment:
Combined p-value:
3.5e-79 /
Annotated Sequence
GrbZIP44-41.0e-75
1
1
Change the portion of annotated sequence by dragging the buttons; hold shift to drag them individually.
Sequence Comment:
Combined p-value:
1.2e-77 /
Annotated Sequence
GrbZIP39-14.1e-75
1
1
Change the portion of annotated sequence by dragging the buttons; hold shift to drag them individually.
Sequence Comment:
Combined p-value:
4.8e-77 /
Annotated Sequence
GrbZIP39-24.4e-75
1
1
Change the portion of annotated sequence by dragging the buttons; hold shift to drag them individually.
Sequence Comment:
Combined p-value:
5.1e-77 /
Annotated Sequence
GrbZIP36-47.9e-75
1
1
Change the portion of annotated sequence by dragging the buttons; hold shift to drag them individually.
Sequence Comment:
Combined p-value:
9.2e-77 /
Annotated Sequence
GrbZIP354.3e-74
1
1
Change the portion of annotated sequence by dragging the buttons; hold shift to drag them individually.
Sequence Comment:
Combined p-value:
5.0e-76 /
Annotated Sequence
GrbZIP36-21.6e-73
1
1
Change the portion of annotated sequence by dragging the buttons; hold shift to drag them individually.
Sequence Comment:
Combined p-value:
1.8e-75 /
Annotated Sequence
GrbZIP371.3e-72
1
1
Change the portion of annotated sequence by dragging the buttons; hold shift to drag them individually.
Sequence Comment:
Combined p-value:
1.5e-74 /
Annotated Sequence
GrbZIP27.5e-72
1
1
Change the portion of annotated sequence by dragging the buttons; hold shift to drag them individually.
Sequence Comment:
Combined p-value:
8.8e-74 /
Annotated Sequence
GrbZIP122.3e-71
1
1
Change the portion of annotated sequence by dragging the buttons; hold shift to drag them individually.
Sequence Comment:
Combined p-value:
2.7e-73 /
Annotated Sequence
GrbZIP66-13.5e-70
1
1
Change the portion of annotated sequence by dragging the buttons; hold shift to drag them individually.
Sequence Comment:
Combined p-value:
4.0e-72 /
Annotated Sequence
GrbZIP674.7e-69
1
1
Change the portion of annotated sequence by dragging the buttons; hold shift to drag them individually.
Sequence Comment:
Combined p-value:
5.5e-71 /
Annotated Sequence
GrbZIP11-28.2e-66
1
1
Change the portion of annotated sequence by dragging the buttons; hold shift to drag them individually.
Sequence Comment:
Combined p-value:
9.5e-68 /
Annotated Sequence
GrbZIP13-21.8e-58
1
1
Change the portion of annotated sequence by dragging the buttons; hold shift to drag them individually.
Sequence Comment:
Combined p-value:
2.1e-60 /
Annotated Sequence
GrbZIP66-21.1e-54
1
1
Change the portion of annotated sequence by dragging the buttons; hold shift to drag them individually.
Sequence Comment:
Combined p-value:
1.2e-56 /
Annotated Sequence
GrbZIP13-12.0e-54
1
1
Change the portion of annotated sequence by dragging the buttons; hold shift to drag them individually.
Sequence Comment:
Combined p-value:
2.4e-56 /
Annotated Sequence
GrbZIP66-35.5e-53
1
1
Change the portion of annotated sequence by dragging the buttons; hold shift to drag them individually.
Sequence Comment:
Combined p-value:
6.4e-55 /
Annotated Sequence
GrbZIP44-52.9e-40
1
1
Change the portion of annotated sequence by dragging the buttons; hold shift to drag them individually.
Sequence Comment:
Combined p-value:
3.4e-42 /
Annotated Sequence
GrbZIP42-11.6e-37
1
1
Change the portion of annotated sequence by dragging the buttons; hold shift to drag them individually.
Sequence Comment:
Combined p-value:
1.8e-39 /
Annotated Sequence
GrbZIP585.3e-37
1
1
Change the portion of annotated sequence by dragging the buttons; hold shift to drag them individually.
Sequence Comment:
Combined p-value:
6.2e-39 /
Annotated Sequence
GrbZIP65.7e-37
1
1
Change the portion of annotated sequence by dragging the buttons; hold shift to drag them individually.
Sequence Comment:
Combined p-value:
6.6e-39 /
Annotated Sequence
GrbZIP434.1e-36
1
1
Change the portion of annotated sequence by dragging the buttons; hold shift to drag them individually.
Sequence Comment:
Combined p-value:
4.8e-38 /
Annotated Sequence
GrbZIP53-11.7e-35
1
1
Change the portion of annotated sequence by dragging the buttons; hold shift to drag them individually.
Sequence Comment:
Combined p-value:
1.9e-37 /
Annotated Sequence
GrbZIP5-24.9e-35
1
1
Change the portion of annotated sequence by dragging the buttons; hold shift to drag them individually.
Sequence Comment:
Combined p-value:
5.7e-37 /
Annotated Sequence
GrbZIP42-26.2e-35
1
1
Change the portion of annotated sequence by dragging the buttons; hold shift to drag them individually.
Sequence Comment:
Combined p-value:
7.2e-37 /
Annotated Sequence
GrbZIP5-31.1e-34
1
1
Change the portion of annotated sequence by dragging the buttons; hold shift to drag them individually.
Sequence Comment:
Combined p-value:
1.3e-36 /
Annotated Sequence
GrbZIP404.5e-34
1
1
Change the portion of annotated sequence by dragging the buttons; hold shift to drag them individually.
Sequence Comment:
Combined p-value:
5.2e-36 /
Annotated Sequence
GrbZIP18-16.9e-34
1
1
Change the portion of annotated sequence by dragging the buttons; hold shift to drag them individually.
Sequence Comment:
Combined p-value:
8.0e-36 /
Annotated Sequence
GrbZIP53-38.0e-34
1
1
Change the portion of annotated sequence by dragging the buttons; hold shift to drag them individually.
Sequence Comment:
Combined p-value:
9.3e-36 /
Annotated Sequence
GrbZIP72.1e-33
1
1
Change the portion of annotated sequence by dragging the buttons; hold shift to drag them individually.
Sequence Comment:
Combined p-value:
2.4e-35 /
Annotated Sequence
GrbZIP69-21.6e-32
1
1
Change the portion of annotated sequence by dragging the buttons; hold shift to drag them individually.
Sequence Comment:
Combined p-value:
1.8e-34 /
Annotated Sequence
GrbZIP524.1e-32
1
1
Change the portion of annotated sequence by dragging the buttons; hold shift to drag them individually.
Sequence Comment:
Combined p-value:
4.7e-34 /
Annotated Sequence
GrbZIP51-27.5e-32
1
1
Change the portion of annotated sequence by dragging the buttons; hold shift to drag them individually.
Sequence Comment:
Combined p-value:
8.7e-34 /
Annotated Sequence
GrbZIP29-11.0e-30
1
1
Change the portion of annotated sequence by dragging the buttons; hold shift to drag them individually.
Sequence Comment:
Combined p-value:
1.2e-32 /
Annotated Sequence
GrbZIP631.9e-30
1
1
Change the portion of annotated sequence by dragging the buttons; hold shift to drag them individually.
Sequence Comment:
Combined p-value:
2.2e-32 /
Annotated Sequence
GrbZIP53-46.7e-30
1
1
Change the portion of annotated sequence by dragging the buttons; hold shift to drag them individually.
Sequence Comment:
Combined p-value:
7.8e-32 /
Annotated Sequence
GrbZIP5-11.2e-29
1
1
Change the portion of annotated sequence by dragging the buttons; hold shift to drag them individually.
Sequence Comment:
Combined p-value:
1.4e-31 /
Annotated Sequence
GrbZIP251.9e-29
1
1
Change the portion of annotated sequence by dragging the buttons; hold shift to drag them individually.
Sequence Comment:
Combined p-value:
2.3e-31 /
Annotated Sequence
GrbZIP29-22.9e-29
1
1
Change the portion of annotated sequence by dragging the buttons; hold shift to drag them individually.
Sequence Comment:
Combined p-value:
3.4e-31 /
Annotated Sequence
GrbZIP53-23.6e-29
1
1
Change the portion of annotated sequence by dragging the buttons; hold shift to drag them individually.
Sequence Comment:
Combined p-value:
4.1e-31 /
Annotated Sequence
GrbZIP45.5e-29
1
1
Change the portion of annotated sequence by dragging the buttons; hold shift to drag them individually.
Sequence Comment:
Combined p-value:
6.4e-31 /
Annotated Sequence
GrbZIP701.6e-28
1
1
Change the portion of annotated sequence by dragging the buttons; hold shift to drag them individually.
Sequence Comment:
Combined p-value:
1.9e-30 /
Annotated Sequence
GrbZIP302.9e-28
1
1
Change the portion of annotated sequence by dragging the buttons; hold shift to drag them individually.
Sequence Comment:
Combined p-value:
3.4e-30 /
Annotated Sequence
GrbZIP12.9e-28
1
1
Change the portion of annotated sequence by dragging the buttons; hold shift to drag them individually.
Sequence Comment:
Combined p-value:
3.4e-30 /
Annotated Sequence
GrbZIP276.7e-28
1
1
Change the portion of annotated sequence by dragging the buttons; hold shift to drag them individually.
Sequence Comment:
Combined p-value:
7.8e-30 /
Annotated Sequence
GrbZIP18-37.1e-28
1
1
Change the portion of annotated sequence by dragging the buttons; hold shift to drag them individually.
Sequence Comment:
Combined p-value:
8.2e-30 /
Annotated Sequence
GrbZIP101.6e-27
1
1
Change the portion of annotated sequence by dragging the buttons; hold shift to drag them individually.
Sequence Comment:
Combined p-value:
1.8e-29 /
Annotated Sequence
GrbZIP14-37.6e-27
1
1
Change the portion of annotated sequence by dragging the buttons; hold shift to drag them individually.
Sequence Comment:
Combined p-value:
8.9e-29 /
Annotated Sequence
GrbZIP14-27.9e-27
1
1
Change the portion of annotated sequence by dragging the buttons; hold shift to drag them individually.
Sequence Comment:
Combined p-value:
9.2e-29 /
Annotated Sequence
GrbZIP592.3e-26
1
1
Change the portion of annotated sequence by dragging the buttons; hold shift to drag them individually.
Sequence Comment:
Combined p-value:
2.7e-28 /
Annotated Sequence
GrbZIP69-13.9e-26
1
1
Change the portion of annotated sequence by dragging the buttons; hold shift to drag them individually.
Sequence Comment:
Combined p-value:
4.6e-28 /
Annotated Sequence
GrbZIP41-29.5e-23
1
1
Change the portion of annotated sequence by dragging the buttons; hold shift to drag them individually.
Sequence Comment:
Combined p-value:
1.1e-24 /
Annotated Sequence
GrbZIP61-22.1e-22
1
1
Change the portion of annotated sequence by dragging the buttons; hold shift to drag them individually.
Sequence Comment:
Combined p-value:
2.4e-24 /
Annotated Sequence
GrbZIP168.7e-22
1
1
Change the portion of annotated sequence by dragging the buttons; hold shift to drag them individually.
Sequence Comment:
Combined p-value:
1.0e-23 /
Annotated Sequence
GrbZIP14-12.0e-21
1
1
Change the portion of annotated sequence by dragging the buttons; hold shift to drag them individually.
Sequence Comment:
Combined p-value:
2.3e-23 /
Annotated Sequence
GrbZIP51-17.9e-21
1
1
Change the portion of annotated sequence by dragging the buttons; hold shift to drag them individually.
Sequence Comment:
Combined p-value:
9.2e-23 /
Annotated Sequence
GrbZIP18-21.2e-20
1
1
Change the portion of annotated sequence by dragging the buttons; hold shift to drag them individually.
Sequence Comment:
Combined p-value:
1.4e-22 /
Annotated Sequence
GrbZIP55-12.1e-20
1
1
Change the portion of annotated sequence by dragging the buttons; hold shift to drag them individually.
Sequence Comment:
Combined p-value:
2.4e-22 /
Annotated Sequence
GrbZIP61-16.4e-20
1
1
Change the portion of annotated sequence by dragging the buttons; hold shift to drag them individually.
Sequence Comment:
Combined p-value:
7.4e-22 /
Annotated Sequence
GrbZIP55-31.6e-19
1
1
Change the portion of annotated sequence by dragging the buttons; hold shift to drag them individually.
Sequence Comment:
Combined p-value:
1.9e-21 /
Annotated Sequence
GrbZIP93.7e-19
1
1
Change the portion of annotated sequence by dragging the buttons; hold shift to drag them individually.
Sequence Comment:
Combined p-value:
4.3e-21 /
Annotated Sequence
GrbZIP41-12.5e-18
1
1
Change the portion of annotated sequence by dragging the buttons; hold shift to drag them individually.
Sequence Comment:
Combined p-value:
2.9e-20 /
Annotated Sequence
GrbZIP564.9e-16
1
1
Change the portion of annotated sequence by dragging the buttons; hold shift to drag them individually.
Sequence Comment:
Combined p-value:
5.7e-18 /
Annotated Sequence
GrbZIP343.3e-14
1
1
Change the portion of annotated sequence by dragging the buttons; hold shift to drag them individually.
Sequence Comment:
Combined p-value:
3.8e-16 /
Annotated Sequence
GrbZIP196.4e-14
1
1
Change the portion of annotated sequence by dragging the buttons; hold shift to drag them individually.
Sequence Comment:
Combined p-value:
7.5e-16 /
Annotated Sequence
GrbZIP602.8e-13
1
1
Change the portion of annotated sequence by dragging the buttons; hold shift to drag them individually.
Sequence Comment:
Combined p-value:
3.2e-15 /
Annotated Sequence
GrbZIP624.6e-12
1
1
Change the portion of annotated sequence by dragging the buttons; hold shift to drag them individually.
Sequence Comment:
Combined p-value:
5.4e-14 /
Annotated Sequence
GrbZIP461.0e-11
1
1
Change the portion of annotated sequence by dragging the buttons; hold shift to drag them individually.
Sequence Comment:
Combined p-value:
1.2e-13 /
Annotated Sequence
GrbZIP171.1e-11
1
1
Change the portion of annotated sequence by dragging the buttons; hold shift to drag them individually.
Sequence Comment:
Combined p-value:
1.3e-13 /
Annotated Sequence
GrbZIP231.1e-11
1
1
Change the portion of annotated sequence by dragging the buttons; hold shift to drag them individually.
Sequence Comment:
Combined p-value:
1.3e-13 /
Annotated Sequence
GrbZIP763.7e-11
1
1
Change the portion of annotated sequence by dragging the buttons; hold shift to drag them individually.
Sequence Comment:
Combined p-value:
4.4e-13 /
Annotated Sequence
EKRQRRMJSNRESARRSRMRKQAYLEELE
SQQYTLVZRDNSVLRAZNSELKQRLQSLE
LNHYDEJFRLKATAAKADVFYLJSGMWKTPAERFFLWIGGFRPSELLKVL
GKTLGEMTLEEFLVNAGVVEE
ALEGFVRQADHLRQQTLQQMHRILTTRQAARGLLAJGEYFHRLRALSSL
GKGLVSGGSLQRQGSLSLPRTLSQKTVDEVWKEIQKEQDGGKQ
FGLSGTVNSGIAAFEMEYGRWVEEQNRQICELRTALNAHISDIELRILVE
PQJEPLTEQQLLEVCNLQQSSQQAEDALSQGLEKLQQSLAETVASG
ZVEQLREENAELRKK
MSPVVSEILRSGFMINSSLRRRTHLVQSFSVVFLYCGNS

Inputs & Settings

Prev Next Top

Alphabet

    Background Source: an old version of the NCBI non-redundant database

Name 
Bg. 
AAlanine0.0730919
CCysteine0.0181455
DAspartic acid0.051688
EGlutamic acid0.0622785
FPhenylalanine0.0402434
GGlycine0.0692596
HHistidine0.0224055
IIsoleucine0.056227
KLysine0.058435
LLeucine0.0916218
MMethionine0.0230443
NAsparagine0.0460321
PProline0.0506238
QGlutamine0.0407153
RArginine0.0518462
SSerine0.073729
TThreonine0.0593523
VValine0.0642985
WTryptophan0.0133282
YTyrosine0.0326497

Sequences

The following sequence database was supplied to MAST.

Database
Sequence Count
Residue Count
Last Modified
sequences.fa8626648Wed Jul 29 05:51:12 2020
Total8626648 

Motifs

The following motif database was supplied to MAST.

Database
Last Modified
meme.xmlWed Jul 29 06:07:26 2020

Other Settings

Strand Handling The alphabet is unstranded.
Max Correlation Motifs with a correlation greater than 0.6 are marked for potential removal dependant on the --remcorr option.
Remove Correlated Correlated motifs exceeding the threshold are highlighted and their removal is recommended.
Max Sequence E-value Sequences with an E-value less than 10 are included in the output.
Adjust Hit p-value The hit p-value is not adjusted for the length of the sequence.
Displayed Hits The p-value of a hit must be less than 0.0001 to be shown in the output.
Displayed Weak Hits Weak hits are not displayed.
Prev Top
MAST version 5.1.1
(Release date: Wed Jan 29 15:00:42 2020 -0800)
Reference
Timothy L. Bailey and Michael Gribskov, "Combining evidence using p-values: application to sequence homology searches", Bioinformatics, 14(1):48-54, 1998.
Command line summary
Ran in 0.168 seconds on Wed Jul 29 06:07:27 2020 on ip-172-31-11-51